PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03409.1.p
Common NameEUGRSUZ_B03409, LOC104433601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 318aa    MW: 35629 Da    PI: 4.3929
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03409.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.4e-1992145356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++++q++ Le++Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Eucgr.B03409.1.p  92 KKRRLSADQVHFLERHFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARYK 145
                       55689************************************************9 PP

2HD-ZIP_I/II127.26.9e-4192181291
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       kkrrls++qv++LE++Fe e+kLeperK +la++Lglqprqva+WFqnrRAR+ktkqlEkdy++Lk+++++lk+++++L ke+e+L+ e+
  Eucgr.B03409.1.p  92 KKRRLSADQVHFLERHFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARYKTKQLEKDYDSLKARFESLKADHDKLIKEKENLKGEV 181
                       9*************************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1984149IPR009057Homeodomain-like
PROSITE profilePS5007116.97387147IPR001356Homeobox domain
SMARTSM003892.6E-1989151IPR001356Homeobox domain
CDDcd000869.03E-1890148No hitNo description
PfamPF000462.8E-1692145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-1994155IPR009057Homeodomain-like
PRINTSPR000311.3E-5118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5127143IPR000047Helix-turn-helix motif
PfamPF021835.8E-15147188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MAGEEPYSAD TNSDTFADEE TLIPSSSEAL ESAWVPTSST AHHGSKSVVN FEDVCGGGDT  60
NTAPRPYLRQ IDLKEEAVEE DYGDGNFQPP GKKRRLSADQ VHFLERHFEV ENKLEPERKI  120
QLAKDLGLQP RQVAIWFQNR RARYKTKQLE KDYDSLKARF ESLKADHDKL IKEKENLKGE  180
VLSLRDKLRS RAKGSEEGSL EADDSLRGAT PKPTTPSTLD DVSYVDATIL KQEDVSSAKS  240
DVFDSDSLLE PANSSHVFEP DCSDFSQDED DSFGKSLLPL DFLPRFDDGY AFQQNPPAIS  300
CNFAFPAEEN PFWSWSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARYKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03409.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044703.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_010044704.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022831e-42HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A059D8Q70.0A0A059D8Q7_EUCGR; Uncharacterized protein
STRINGVIT_01s0026g01550.t012e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-44homeobox 1